Description

  • Product name

    Recombinant Human Brd4 protein (Tagged)
    See all Brd4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYY KIIKTPMDMGTIKKRLENNYYWNAQECIQDFN TMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTP DLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQ PVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKP PKKDVPDSQQHPAPEKSSKV SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDM STIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVF EMRFAKMPDE
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      49 to 460
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Bromodomains 1 and 2.

Specifications

Our Abpromise guarantee covers the use of ab176941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    Information available upon request.

General Info

  • Alternative names

    • Brd4
    • BRD4-NUT FUSION
    • BRD4-NUT fusion oncoprotein
    • BRD4_HUMAN
    • Bromodomain containing 4
    • bromodomain containing protein 4
    • Bromodomain-containing protein 4
    • CAP
    • chromosome associated protein
    • HUNK1
    • HUNKI
    • MCAP
    • Mitotic chromosome-associated protein
    • Protein HUNK1
    see all
  • Function

    Plays a role in a process governing chromosomal dynamics during mitosis.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Note=A chromosomal aberration involving BRD4 is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;19)(q14;p13) with NUT which produces a BRD4-NUT fusion protein.
  • Sequence similarities

    Contains 2 bromo domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176941.

    Lane 1; 5 µg

    Lane 2; 2.5 µg

References

ab176941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The concentration of batch GR319568-3 is 0.85 mg/ml.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up