Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFG TMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGF KMMSKQAA
    • Molecular weight
      13 kDa including tags
    • Amino acids
      135 to 242
    • Tags
      His tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_023924

Specifications

Our Abpromise guarantee covers the use of ab196142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 79 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% Tween, 20% Glycerol

General Info

  • Alternative names
    • Bromodomain containing 9
    • Bromodomain containing protein 9
    • DKFZp434D0711
    • DKFZp686L0539
    • FLJ13441
    • LAVS3040
    • PRO9856
    • Rhabdomyosarcoma antigen MU RMS 40.8
    • Sarcoma antigen NY SAR 29
    • UNQ3040
    see all
  • Relevance
    BRD9 is a bromodomain containing protein, which are known to bind to acetylated lysine residues.

Images

  • 4-20% SDS-PAGE analysis of 2.5 µg ab196142 with Coomassie staining.

References

ab196142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up