Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGL HNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDH EVVTMARMLQDVFETHFSKI PIEPVE
    • Molecular weight
      15 kDa including tags
    • Amino acids
      257 to 382
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • BRD 6
    • BRD6
    • Brdt
    • BRDT protein
    • BRDT_HUMAN
    • Bromodomain testis specific
    • Bromodomain testis specific protein
    • Bromodomain testis-specific protein
    • Cancer/testis antigen 9
    • CT9
    • RING3 like protein
    • RING3-like protein
    • Testis specific bromodomain protein
    see all
  • Function
    May play a role in the transcriptional regulation of spermatogenesis. Seems to have a structural ATP-independent role in the reorganization of acetylated chromatin.
  • Tissue specificity
    Testis-specific. A 3-fold higher expression is seen in adult testis than in embryo testis. Expression seems to be correlated with histone H4 hyperacetylation during the haploid phase of spermatogenesis (spermiogenesis). No expression, or very low expression is seen in patients' testes with abnormal spermatogenesis. Expressed in cancers such as non-small cell lung cancer and squamous cell carcinomas of the head and neck as well as of esophagus, but not in melanoma or in cancers of the colon, breast, kidney and bladder.
  • Sequence similarities
    Contains 2 bromo domains.
  • Developmental stage
    Expressed in embryo testis.
  • Domain
    The two bromodomains are involved in the specific recognition of histone H4 acetylated N-terminus.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab176961.

    Lane 1: Markers:
    Lane 2: ab176961 (10 μg)
    Lane 3: ab176961 (25 μg)
    Lane 4: ab176961 (50 μg)

References

ab176961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up