Overview

  • Product name

    Recombinant Human Brevican protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLG GALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKV NEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAV EVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGY EQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYC YAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDH CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNV YCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESE SRGAIYSIPIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEG KALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPGPEASLPTEPA AQEKSLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERN LASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRA PEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDC VPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACY KHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDR TIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPC NYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQ RNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKAL LIPPSSPMPGP
    • Amino acids

      1 to 911
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BCAN
    • BEHAB
    • Brain enriched hyaluronan binding protein
    • Brevican core protein
    • Brevican core protein isoform 1
    • Brevican core protein isoform 2
    • Brevican proteoglycan
    • Chondroitin sulfate proteoglycan 7
    • Chondroitin sulfate proteoglycan BEHAB
    • CSPG7
    • MGC13038
    see all
  • Relevance

    Brevican is the most abundant chondroitin sulfate proteoglycan in the extracellular matrix of the adult brain. It is a member of the lectican family of aggregating extracellular matrix proteoglycans that bear chondroitin sulfate (CS) chains. It is highly expressed in the central nervous system and is thought to stabilize synapses and inhibit neural plasticity. Brevican is secreted from astrocytes and neurons as a 145 kD core protein that bears up to three, covalently-linked, CS chains. It is also is secreted as a 145 kD core protein without CS chains. When cleaved by extracellular glutamyl endopeptidases, the ADAMTSs, a 55 kD N-terminal fragment is formed that contains the unique C-terminal epitope EAMESE.
  • Cellular localization

    Isoform 1 is secreted, extracellular space, extracellular matrix; Isoform 2 is found on the membrane; Lipid-anchor, GPI-anchor.

Images

  • ab153476 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up