Description

  • Product name

    Recombinant Human BRI3BP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTV NTFSQSVSSLFGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLD VLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVL HVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGP MGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKD K
    • Amino acids

      1 to 251
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BNAS1
    • BRI3 binding protein
    • BRI3-binding protein
    • BRI3B_HUMAN
    • Bri3bp
    • Cervical cancer 1 proto oncogene binding protein KG19
    • Cervical cancer 1 proto-oncogene-binding protein KG19
    • cervical cancer oncogene binding protein
    • HCCR-2
    • HCCR1
    • HCCRBP-1
    • I3 binding protein
    • I3-binding protein
    • KG19
    see all
  • Function

    Involved in tumorigenesis and may function by stabilizing p53/TP53.
  • Tissue specificity

    Most abundantly expressed in brain, liver and kidney. Overexpressed in leukemia and lymphoma cell lines, as well as in various carcinomas.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab165475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up