Description

  • Product name

    Recombinant Human Brn-2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab134864 was expressed in E.coli, refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      29aa_Tag_GEFATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAHS LVQGDYGALHSNGHPLSHAHQWITALSHGGGDGSPWSTSPLGQPDIKPSV VVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHH AANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQP AGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHD PHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTT ICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKK RTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQ KEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQLEESGGGGSPGRRR RRRRRRRR
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      2 to 443

Associated products

Specifications

Our Abpromise guarantee covers the use of ab134864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein name formally labeled as POU3F2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: Potassium chloride, 0.32% Tris HCl, EDTA, Glycerol, Sodium chloride
    Note: Proprietary formulation also includes arginine and DTT.

General Info

  • Alternative names

    • Brain 2
    • Brain specific homeobox/POU domain protein 2
    • Brain-2
    • Brain-specific homeobox/POU domain protein 2
    • BRN 2
    • Brn-2
    • BRN2
    • N Oct 3
    • N OCT 3 Gene
    • N Oct3
    • Nervous system specific octamer binding transcription factor
    • Nervous system-specific octamer-binding transcription factor N-Oct-3
    • OCT 7
    • Oct-7
    • OCT7
    • Octamer Binding Transcription Factor 7
    • Octamer-binding protein 7
    • Octamer-binding transcription factor 7
    • OTF 7
    • OTF-7
    • OTF7
    • PO3F2_HUMAN
    • POU class 3 homeobox 2,
    • POU domain class 3 transcription factor 2
    • POU domain, class 3, transcription factor 2
    • Pou3f2
    • POUF 3
    • POUF3
    • Protein Brn 2
    see all
  • Function

    Transcription factor that binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a nonconserved spacer region of 0, 2, or 3 nucleotides. Positively regulates the genes under the control of corticotropin-releasing hormone (CRH) and CRH II promoters.
  • Tissue specificity

    Expressed specifically in the neuroectodermal cell lineage.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up