Recombinant Human BRN3A protein (ab152627)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, SDS-PAGE, ELISA
Description
-
Product name
Recombinant Human BRN3A protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPR PSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY -
Predicted molecular weight
36 kDa including tags -
Amino acids
330 to 419
-
Specifications
Our Abpromise guarantee covers the use of ab152627 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Brain specific homeobox/POU domain protein 3A
- Brain-3A
- Brain-specific homeobox/POU domain protein 3A
see all -
Function
Probable transcription factor which may play a role in the regulation of specific gene expression within a subset of neuronal lineages. May play a role in determining or maintaining the identities of a small subset of visual system neurons. -
Tissue specificity
Brain. Seems to be specific to the retina. Present in the developing brain, spinal cord and eye. -
Sequence similarities
Belongs to the POU transcription factor family. Class-4 subfamily.
Contains 1 homeobox DNA-binding domain.
Contains 1 POU-specific domain. -
Developmental stage
Expression peaks early in embryogenesis (day 13.5) and is undetectable 14 days after birth. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab152627 has not yet been referenced specifically in any publications.