Overview

  • Product name

    Recombinant Human BRN4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNG HPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPH VAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGL TPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQ FKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKP LLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKC PKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSH TVKTDTSCHDL
    • Molecular weight

      67 kDa including tags
    • Amino acids

      1 to 361

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brain specific homeobox POU domain protein 4
    • Brain-4
    • Brain-specific homeobox/POU domain protein 4
    • BRAIN4
    • Brn-4
    • BRN4
    • class 3
    • DFN3
    • DFNX2
    • Oct-9
    • Octamer-binding protein 9
    • Octamer-binding transcription factor 9
    • OTF-9
    • OTF9
    • PO3F4_HUMAN
    • POU class 3 homeobox 4
    • POU domain
    • POU domain class 3 transcription factor 4
    • Pou3f4
    • transcription factor 4
    see all
  • Function

    Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain.
  • Tissue specificity

    Brain specific.
  • Involvement in disease

    Defects in POU3F4 are a cause of deafness X-linked type 2 (DFNX2) [MIM:304400]. A mixed type of deafness characterized by both conductive hearing loss resulting from stapes (perilymphatic gusher) fixation and progressive sensorineural deafness.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up