Recombinant Human Brorin protein (ab182824)

Overview

  • Product name

    Recombinant Human Brorin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPSIPLEKLAQAPEQPGQEKR EHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWV SQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYP DYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPR CIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVL CTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECT ICHCTYEEGTWRIERQAMCTRHECRQM
    • Molecular weight

      36 kDa including tags
    • Amino acids

      28 to 325
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site tag (29aa) fusion at its N-terminal (NP_940972).

Specifications

Our Abpromise guarantee covers the use of ab182824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab182824 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Additional notes

    Previously labelled as VWC2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • Brain-specific chordin-like protein
    • Brorin
    • PSST739
    • UNQ739
    • von Willebrand factor C domain containing 2
    • von Willebrand factor C domain-containing protein 2
    • VWC2
    • VWC2_HUMAN
    see all
  • Function

    BMP antagonist which may play a role in neural development. Promotes cell adhesion.
  • Sequence similarities

    Contains 2 VWFC domains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

References

ab182824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up