Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KREQVKVQQAAMELELMPFNVLLRTTLDLLQEKDPAHIFAEPVNLSEVPD YLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNLIVTNCMKYNAKDTIF HRAAVRLRDLGGAILRHARRQAENIG
    • Molecular weight
      41 kDa including tags
    • Amino acids
      576 to 701
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      Bromodomain.

Specifications

Our Abpromise guarantee covers the use of ab176935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

General Info

  • Alternative names
    • Bromodomain and PHD finger containing protein 3
    • Bromodomain and PHD finger containing, 3
    • KIAA1286
  • Relevance
    BRPF3 is a bromodomain and PHD finger containing protein.
  • Cellular localization
    Nuclear

Images

  • SDS-PAGE analysis of ab176935.

    Lane 1; 8 µg

    Lane 2; 4 µg

    Lane 3; 2 µg

References

ab176935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up