Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIV NREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSG GELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLD EKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVW SCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGM IEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDP DVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDE DLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRA IEMAQHGQRSRSISGASSGLSTSPLSSPRVTPHPSPRGSPLPTPKGTPVH TPKESPAGTPNPTPPSSPSVGGVPWRARLNSIKNSFLGSPRFHRRKLQVP TPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADI VHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGE AQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSDTTN CMEMMTGRLSKCGIIPKS
    • Molecular weight

      108 kDa including tags
    • Amino acids

      1 to 668
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab139629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab139629 was determined to be 105 nmol/min/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity

    >= 95 % Densitometry.

  • Form

    Liquid
  • Additional notes

    ab204854 (Cdc25C peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BR serine/threonine kinase 2
    • BR serine/threonine-protein kinase 2
    • Brain selective kinase 2
    • Brain specific serine/threonine protein kinase 2
    • Brsk2
    • BRSK2_HUMAN
    • C11orf7
    • PEN11B
    • Protein kinase SAD1B
    • SAD1
    • SADA
    • Serine/threonine kinase 29
    • Serine/threonine protein kinase BRSK2
    • Serine/threonine-protein kinase 29
    • Serine/threonine-protein kinase SAD-A
    • STK29
    see all
  • Function

    Required for the polarization of forebrain neurons which endows axons and dendrites with distinct properties, possibly by locally regulating phosphorylation of microtubule-associated proteins.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab139629
  • The specific activity of ab139629 was determined to be 105 nmol/min/mg.

References

ab139629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up