Overview

  • Product name

    Recombinant Human BS69 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHS AVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARML YKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFW PAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWK KACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPR AKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLS ASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVV REALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIK KLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEH KRTCRRKR
    • Amino acids

      1 to 508
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adenovirus 5 E1A binding protein
    • Bone morphogenetic protein receptor associated molecule 1
    • BRAM1
    • BS69 variant 1
    • BS69 variant 2
    • BS69 variant 3
    • BS69 variant 4
    • RP11-486H9.1
    • Zinc finger MYND domain containing 11
    • zinc finger MYND domain containing protein 11
    • zinc finger, MYND type containing 11
    • ZMYND11
    see all
  • Relevance

    BS69 is a factor previously identified as an adenovirus E1A-associated protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Two transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Nuclear

Images

  • ab161146 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up