Recombinant Human BST2/Tetherin protein (ab114390)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, SDS-PAGE, ELISA
Description
-
Product name
Recombinant Human BST2/Tetherin protein
See all BST2/Tetherin proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAA TCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRR ENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ -
Predicted molecular weight
41 kDa including tags -
Amino acids
40 to 180
-
Specifications
Our Abpromise guarantee covers the use of ab114390 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as BST2.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Bone marrow stromal antigen 2
- Bone marrow stromal cell antigen
- Bone marrow stromal cell antigen 2
see all -
Function
May be involved in the sorting of secreted proteins (By similarity). May be involved in pre-B-cell growth. Antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. May play a role in B-cell activation in rheumatoid arthritis. -
Tissue specificity
Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly expressed on T-cells, monocytes, NK cells and dendritic cells (at protein level). -
Sequence similarities
Belongs to the tetherin family. -
Domain
The extracellular coiled coil domain is important for virus retention at the cell surface and prevention of virus spreading. -
Post-translational
modificationsMonoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation. -
Cellular localization
Golgi apparatus > trans-Golgi network. Cell membrane. Cell membrane. Late endosome. Targeted to late endosomes upon KSHV infection and subsequent ubiquitination. Targeted to the trans-Golgi network by viral VPU protein. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab114390 has not yet been referenced specifically in any publications.