Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFT LDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
    • Amino acids
      1750 to 1849
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TAF172.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent helicase BTAF1
    • ATP-dependent helicase BTAF1
    • B-TFIID transcription factor associated 170 kDa subunit
    • B-TFIID transcription factor associated, 170kDa (Mot1 homolog, S. cerevisiae)
    • B-TFIID transcription factor-associated 170 kDa subunit
    • BTAF 1 RNA polymerase II
    • BTAF1
    • BTAF1 RNA polymerase II B TFIID transcription factor associated 170kDa
    • BTAF1_HUMAN
    • MOT 1
    • MOT1
    • MOT1 Yeast homolog of
    • TAF 172
    • TAF II 170
    • TAF(II)170
    • TAF-172
    • TAF172
    • TAFII170
    • TATA binding protein associated factor 172
    • TATA-binding protein-associated factor 172
    • TBP associated factor 172
    • TBP-associated factor 172
    see all
  • Function
    Regulates transcription in association with TATA binding protein (TBP). Removes TBP from the TATA box in an ATP-dependent manner.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 8 HEAT repeats.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160305 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up