Overview

  • Product name
    Recombinant Human BTBD15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLA ACSDFFRTKLVGQAEDENKNVLDLHHVTVTGFIPLLEYAYTATLSINTEN IIDVLAAASYMQMFSVASTCSEFMKSSILWNTPNSQPEKGLDAGQENNSN CNFTSRDGSISPVSSECSVVERTIPVCRESRRKRKSYIVMSPESPVKCGT QTSSPQVLNSSASYSENRNQPVDSSLAFPWTFPFGIDRRIQPEKVKQAEN TRTLELPGPSETGRRMADYVTCESTKTTLPLGTEEDVRVKVERLSDEEVH EEVSQPVSASQSSLSDQQTVPGSEQVQEDLLISPQSSSIGSVDEGVSEGL PTLQSTSSTNAPPDDDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQ CPTCGVRFTRIQNLKQHMLIHSGIKPFQCDRCGKKFTRAYSLKMHRLKHE VIS
    • Amino acids
      1 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BTB (POZ) domain containing 15
    • BTB/POZ domain-containing protein 15
    • BTBD15
    • HSPC063
    • MGC26123
    • MGC57431
    • MGC60348
    • MGC88058
    • OTTHUMP00000230934
    • OTTHUMP00000230935
    • OTTHUMP00000230937
    • OTTHUMP00000230938
    • ZBT44_HUMAN
    • Zbtb44
    • Zinc finger and BTB domain containing 44
    • Zinc finger and BTB domain-containing protein 44
    • Zinc finger protein 851
    • ZNF851
    see all
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 4 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162208 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up