Description

  • Product name

    Recombinant Human BTC protein (Fc Chimera)
    See all BTC proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGR CRFVVAEQTPSCVCDEGYIGARCERVDLFY
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      32 to 111
    • Additional sequence information

      Fused with a Human IgG1 Fc tag at the C-terminus, This product is for the mature full length protein. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab206022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Protein previously labeled as Betacellulin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Betacellulin
    • Betacellulin precursor
    • BTC
    • BTC_HUMAN
    • OTTHUMP00000160600
    • OTTHUMP00000219057
    • Probetacellulin
    see all
  • Function

    Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the EGF receptor and other related receptors.
  • Tissue specificity

    Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab206022, staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 45-50 kDa in SDS-PAGE due to glycosylation.

References

ab206022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up