Overview

  • Product name

    Recombinant Human BTD protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLD IYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWN PCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGR YQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFG IFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVA FGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNP VGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAP PTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALG VFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFS TSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYE RDLEHHHHHH
    • Molecular weight

      58 kDa including tags
    • Amino acids

      44 to 545
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 44 to 545. The signal peptide is not included (NP_001268652).

Specifications

Our Abpromise guarantee covers the use of ab219238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 85 % SDS-PAGE.
    ab219238 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Biotinase
    • Biotinidase
    • Btd
    • BTD_HUMAN
    • EC 3.5.1.12
    see all
  • Function

    Catalytic release of biotin from biocytin, the product of biotin-dependent carboxylases degradation.
  • Involvement in disease

    Defects in BTD are the cause of biotinidase deficiency (BTD deficiency) [MIM:253260]; also called late-onset multiple carboxylase deficiency. BTD deficiency is a juvenile form of multiple carboxylase deficiency, an autosomal recessive disorder of biotin metabolism, characterized by ketoacidosis, hyperammonemia, excretion of abnormal organic acid metabolites, and dermatitis. BTD deficiency is characterized by seizures, hypotonia, skin rash, alopecia, ataxia, hearing loss, and optic atrophy. If untreated, symptoms usually become progressively worse, and coma and death may occur.
  • Sequence similarities

    Belongs to the CN hydrolase family. BTD/VNN subfamily.
    Contains 1 CN hydrolase domain.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219238.

    Molecular weight:  50-70 kDa (SDS-PAGE under reducing conditions).

References

ab219238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up