Description

  • Product name

    Recombinant Human BTF3L4 protein (denatured)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNQEKLAKLQAQVRIGGKGTARRKKKV VHRTATADDKKLQSSLKKLAVNNIAGIEESWTVKHQNQKTLMRKMMMFQI L
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      1 to 78
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Isoform 3
  • Description

    Recombinant Human BTF3L4 protein

Specifications

Our Abpromise guarantee covers the use of ab177710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • Basic transcription factor 3-like 4
    • BT3L4_HUMAN
    • BTF3L4
    • MGC23908
    • MGC88389
    • RP4-800M22.5
    • Transcription factor BTF3 homolog 4
    see all
  • Sequence similarities

    Belongs to the NAC-beta family.
    Contains 1 NAC-A/B (NAC-alpha/beta) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177710 (3µg).

References

ab177710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up