Overview

  • Product name
    Recombinant Human BTG3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEK PSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCE VCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYG EKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKE MEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYP PPVPFGYPNQGRKNKPYRPTPVTWVPPPGMHCDRNHWINPHMLAPH
    • Amino acids
      1 to 296
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Abundant in neuroepithelium area protein
    • ANA
    • BTG family member 3
    • Btg3
    • BTG3_HUMAN
    • Protein BTG3
    • Protein Tob5
    see all
  • Function
    Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
  • Tissue specificity
    Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung.
  • Sequence similarities
    Belongs to the BTG family.
  • Developmental stage
    Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition.
  • Information by UniProt

Images

  • ab161212 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up