Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      APFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLV HRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFF REDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQ WRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLG QEKKVEISIPASSLPRVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      27 to 242
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • BT
    • BT1A1_HUMAN
    • BTN
    • BTN1
    • Btn1a1
    • butyrophilin
    • Butyrophilin subfamily 1 member A1
    • butyrophilin, subfamily 1, member A1
    see all
  • Function

    May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane (By similarity). Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 B30.2/SPRY domain.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane. Secreted.
  • Information by UniProt

References

ab151672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up