Description

  • Product name

    Recombinant Human BTN1A1 protein (Fc Chimera)
    See all BTN1A1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLV HRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFF REDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQ WRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLG QEKKVEISIPASSLPR
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      27 to 242
    • Additional sequence information

      Extracellular domain of BTN1A1 fused with a Human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab219661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BT
    • BT1A1_HUMAN
    • BTN
    • BTN1
    • Btn1a1
    • butyrophilin
    • Butyrophilin subfamily 1 member A1
    • butyrophilin, subfamily 1, member A1
    see all
  • Function

    May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane (By similarity). Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 B30.2/SPRY domain.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane. Secreted.
  • Information by UniProt

Images

  • SDS-PAGE using ab219661 under reducing (Lane 1) and non-reducing (Lane 2) conditions. As a result of glycosylation, the reducing protein migrates at 55-66 kDa and the non-reducing protein migrates at 116-130 kDa.

References

ab219661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up