Overview

  • Product name

    Recombinant Human BTN2A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLR CHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVS KDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPL ISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGL FMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVA LPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKE RVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN
    • Amino acids

      1 to 334
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BK14H9.1
    • BT2.1
    • BT2A1_HUMAN
    • BTF1
    • BTN2A1
    • Butyrophilin BTF1
    • Butyrophilin subfamily 2 member A1
    • CTA-14H9.1
    • DJ3E1.1
    see all
  • Tissue specificity

    Highly expressed in brain, bone marrow, small intestine, muscle, spleen and pancreas. Moderate expression was seen in lung, liver and kidney.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab161302 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up