Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQW SNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGL EKTASISIADPFFRSAQRWIAALAG
    • Molecular weight

      51 kDa including tags
    • Amino acids

      30 to 254
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminal.

Specifications

Our Abpromise guarantee covers the use of ab219670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.75% Glycine, 0.61% Tris buffer, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BT3A1_HUMAN
    • BTN3A1
    • Butyrophilin subfamily 3 member A1
    • CD277
  • Tissue specificity

    Highly expressed in heart, pancreas and lung, Moderately expressed in placenta, liver and muscle.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 B30.2/SPRY domain.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab219670 on SDS-PAGE under reducing (R) and non-reducing (NR) conditions.

    The gel was stained overnight with Coomassie Blue.

    The purity of the protein is greater than 95%.

    As a result of glycosylation, the reducing (R) protein migrates as 55 kDa and the non-reducing (NR) protein migrates as 100-120 kDa.

References

ab219670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up