Description

  • Product name

    Recombinant Human BTN3A2 protein
    See all BTN3A2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQW SNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGL EKTASISIADPFFRSAQPWVDHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      30 to 248
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab191948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Aliquots of reconstituted samples are stable at < -20°C.

General Info

  • Alternative names

    • BT3.2
    • BT3.3
    • BT3A2_HUMAN
    • BTF4
    • BTN3A 2
    • BTN3A2
    • Butyrophilin protein
    • Butyrophilin subfamily 3 member A2
    • Butyrophilin, subfamily 3, member A2
    • CD277
    • FLJ40011
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab191948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up