Recombinant Human BTN3A2 protein (Tagged) (Biotin) (ab246037)

Description

  • Product name

    Recombinant Human BTN3A2 protein (Tagged) (Biotin)
    See all BTN3A2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQW SNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGL EKTASISIADPFFRSAQPW
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      30 to 248
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. AviTag sequence GLNDIFEAQKIEWHE
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 mins at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • BT3.2
    • BT3.3
    • BT3A2_HUMAN
    • BTF4
    • BTN3A 2
    • BTN3A2
    • Butyrophilin protein
    • Butyrophilin subfamily 3 member A2
    • Butyrophilin, subfamily 3, member A2
    • CD277
    • FLJ40011
    see all
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human BTN3A2 protein (Tagged) (ab246037).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. The protein migrates as 30-33 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab246037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up