Recombinant Human Butyrylcholinesterase protein (ab152070)

Overview

  • Product name

    Recombinant Human Butyrylcholinesterase protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLT KWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIP APKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGA LGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAG AASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLT GCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLT DMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEF QEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPL ERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKY LTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRW NNYMMDWKNQFNDYTSKKESCVGLVDHHHHHH
    • Molecular weight

      66 kDa including tags
    • Amino acids

      29 to 602
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152070 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • Acylcholine acylhydrolase
    • BCHE
    • Butyrylcholine esterase
    • CHE1
    • CHE2
    • CHLE_HUMAN
    • Choline esterase II
    • Cholinesterase
    • Cholinesterase (serum) 2
    • Cholinesterase 1
    • E1
    • Pseudocholinesterase
    • Pseudocholinesterase E1
    see all
  • Function

    Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters.
  • Tissue specificity

    Detected in blood plasma (at protein level). Present in most cells except erythrocytes.
  • Involvement in disease

    Defects in BCHE are the cause of butyrylcholinesterase deficiency (BChE deficiency) [MIM:177400]. BChE deficiency is a metabolic disorder characterized by prolonged apnoea after the use of certain anesthetic drugs, including the muscle relaxants succinylcholine or mivacurium and other ester local anesthetics. The duration of the prolonged apnoea varies significantly depending on the extent of the enzyme deficiency. BChE deficiency is a multifactorial disorder. The hereditary condition is transmitted as an autosomal recessive trait.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

The recombinant protein BCHB expressed by HEK293 is glycosylated as shown in our datasheet.



Glycosylation analysis was not done. The MW at 66.1kD is predicted size and the apparent MW is shown as on SDS-PAGE gel which is much larger.



The protein purity is 95% for C560 product.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up