Overview

  • Product name

    Recombinant Human C-4 Methylsterol Oxidase/SC4MOL protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA TWGSLIVHEALYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKV LLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIED TWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFF IGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHH DFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE
    • Amino acids

      1 to 293
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as C-4 Methylsterol Oxidase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1500001G16Rik
    • C 4 methyl sterol
    • C-4 methylsterol oxidase
    • C78600
    • DESP4
    • ERG25
    • Methylsterol monooxygenase 1
    • MGC104344
    • MSMO1
    • MSMO1_HUMAN
    • OTTHUMP00000219757
    • OTTHUMP00000219758
    • OTTHUMP00000219759
    • OTTHUMP00000219760
    • sterol C4 methyl oxidase like
    see all
  • Function

    Catalyzes the first step in the removal of the two C-4 methyl groups of 4,4-dimethylzymosterol.
  • Pathway

    Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 3/6.
  • Involvement in disease

    Microcephaly, congenital cataract, and psoriasiform dermatitis
  • Sequence similarities

    Belongs to the sterol desaturase family.
  • Domain

    The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab159473 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up