Description

  • Product name

    Recombinant human c-Kit (mutated D820 E) protein
    See all c-Kit proteins and peptides
  • Biological activity

    The specific activity of ab184893 was determined to be 16 nmol/min/mg.

  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGK TLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKV LSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSK QEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVR IGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDL AARNILLTHGRITKICDFGLARDIKNESNYVVKGNARLPVKWMAPESIFN CVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPE HAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCS PNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
    • Predicted molecular weight

      73 kDa
    • Amino acids

      544 to 976
    • Modifications

      mutated D820 E
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab184893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    It is recommended to store this protein at -80°C in glycerol to preserve the activity of the protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • C Kit
    • c-Kit
    • c-Kit Ligand
    • CD117
    • Kit
    • Kit Ligand
    • KIT oncogene
    • KIT proto oncogene receptor tyrosine kinase
    • KIT_HUMAN
    • Mast cell growth factor receptor
    • Mast/stem cell growth factor receptor Kit
    • MGF
    • p145 c-kit
    • PBT
    • Piebald trait protein
    • Proto oncogene c Kit
    • Proto oncogene tyrosine protein kinase Kit
    • Proto-oncogene c-Kit
    • SCF Receptor
    • SCFR
    • soluble KIT variant 1
    • Steel Factor Receptor
    • Stem cell factor receptor
    • tyrosine protein kinase Kit
    • Tyrosine-protein kinase Kit
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein
    • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    see all
  • Function

    Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
  • Tissue specificity

    Isoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells.
  • Involvement in disease

    Piebald trait
    Gastrointestinal stromal tumor
    Testicular germ cell tumor
    Leukemia, acute myelogenous
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
    Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.
  • Cellular localization

    Cell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head.
  • Information by UniProt

Images

  • The specific activity of c-Kit (ab184893) was determined to be 9 nmol/min/mg as per activity assay protocol and was equivalent to 16 nmol/min/mg as per radiometric assay
  • SDS PAGE analysis of ab184893
  • SDS PAGE analysis of ab184893
  • SDS-PAGE analysis of ab184893.

  • Kinase Assay determining the specific activity of ab184893 to be 16 nmol/min/mg.

References

ab184893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up