Recombinant human c-Kit protein (Fc Chimera Active) (ab219878)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: ELISA, SDS-PAGE
Description
-
Product name
Recombinant human c-Kit protein (Fc Chimera Active)
See all c-Kit proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Mouse SCF, His Tag with a linear range of 0.05-1.2 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Biotinylated Mouse SCF with a linear range of 0.25-20 ng/ml.
Immobilized ab219878 at 2 μg/mL (100 μL/well) can bind ab219878 with a linear range of 0.4-2 ng/mL (QC tested).
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETN ENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLY GKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSV KRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLRE GEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATL TISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFV NDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVS ELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGM LQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQ SSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHT -
Predicted molecular weight
82 kDa including tags -
Molecular weight information
The protein has a calculated MW of 81.9 kDa. The protein migrates as 116-130 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. -
Amino acids
26 to 516 -
Tags
Fc tag C-Terminus -
Additional sequence information
Fused with a human IgG1 Fc tag at the C-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219878 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride
Lyophilized from 0.22 µm filtered solution.
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- C Kit
- c-Kit
- c-Kit Ligand
see all -
Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1. -
Tissue specificity
Isoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells. -
Involvement in disease
Piebald trait
Gastrointestinal stromal tumor
Testicular germ cell tumor
Leukemia, acute myelogenous -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 protein kinase domain. -
Post-translational
modificationsUbiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7. -
Cellular localization
Cell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head. - Information by UniProt
Images
-
Human CD117, Fc Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized ActiveMax Human SCF, Tag Free at 2 μg/mL (100 μL/well) can bind Human CD117, Fc Tag with a linear range of 0.4-2 ng/mL (QC tested).
-
Human CD1117, Fc Tag (ab219878) at 2 ug/mL (100 uL/well) can bind Mouse SCF, His Tag (ab221333) with a linear range of 0.05-1 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab219878 has not yet been referenced specifically in any publications.