Recombinant human c-Kit protein (Fc Chimera Active) (ab219878)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETN ENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLY GKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSV KRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLRE GEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATL TISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFV NDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVS ELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGM LQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQ SSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHT
    • Molecular weight

      82 kDa including tags
    • Amino acids

      26 to 516
    • Additional sequence information

      Fused with a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab219878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Mouse SCF, His Tag with a linear range of 0.05-1.2 ng/ml.

    Measured by its binding ability in a functional ELISA. Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Biotinylated Mouse SCF with a linear range of 0.25-20 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C Kit
    • c-Kit
    • c-Kit Ligand
    • CD117
    • Kit
    • Kit Ligand
    • KIT oncogene
    • KIT proto oncogene receptor tyrosine kinase
    • KIT_HUMAN
    • Mast cell growth factor receptor
    • Mast/stem cell growth factor receptor Kit
    • MGF
    • p145 c-kit
    • PBT
    • Piebald trait protein
    • Proto oncogene c Kit
    • Proto oncogene tyrosine protein kinase Kit
    • Proto-oncogene c-Kit
    • SCF Receptor
    • SCFR
    • soluble KIT variant 1
    • Steel Factor Receptor
    • Stem cell factor receptor
    • tyrosine protein kinase Kit
    • Tyrosine-protein kinase Kit
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein
    • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    see all
  • Function

    Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
  • Tissue specificity

    Isoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells.
  • Involvement in disease

    Piebald trait
    Gastrointestinal stromal tumor
    Testicular germ cell tumor
    Leukemia, acute myelogenous
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
    Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.
  • Cellular localization

    Cell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head.
  • Information by UniProt

Images

  • Immobilized Human SCF (Tag Free) at 2 µg/mL (100 µL/well) can bind Human CD117 (Fc Tag) with a linear range of 0.5-4 ng/mL (QC tested).
  • SDS-PAGE analysis of ab219878 stained overnight with Coomassie Blue.

    The reduced protein migrates as 100-125 kDa in SDS-PAGE due to glycosylation.

  • Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Mouse SCF, His Tag with a linear range of 0.05-1.2 ng/ml.

  • Immobilized ab219878 at 2 μg/ml (100 μl/well) can bind Biotinylated Mouse SCF with a linear range of 0.25-20 ng/ml.

References

ab219878 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up