Recombinant human c-Myc (mutated T73A) protein (ab135024)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human c-Myc (mutated T73A) protein
See all c-Myc proteins and peptides -
Biological activity
DNA binding activity was demonstrated using cMyc specific DNA binding oligo derived ELISA. Mouse iPS generation activity was measured for each lot of products.
-
Purity
> 90 % SDS-PAGE.
ab135024 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ QQSELQPPAPSEDIWKKFELLPAPPLSPSRRSGLCSPSYVAVTPFSLRGD NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCAESGGGGSPGRRRRRRRRRRR -
Predicted molecular weight
53 kDa including tags -
Amino acids
1 to 454
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab135024 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Additional notes
Incubating ab135024 in culture mediums at concentration of 8 µg/ml may be used for protein derived iPS (PiPS) generation when combined with Oct4-11R, Sox2-11R and Klf4-11R.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-ArginineThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- AU016757
- Avian myelocytomatosis viral oncogene homolog
- bHLHe39
see all -
Function
Participates in the regulation of gene transcription. Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Seems to activate the transcription of growth-related genes. -
Involvement in disease
Note=Overexpression of MYC is implicated in the etiology of a variety of hematopoietic tumors.
Note=A chromosomal aberration involving MYC may be a cause of a form of B-cell chronic lymphocytic leukemia. Translocation t(8;12)(q24;q22) with BTG1.
Defects in MYC are a cause of Burkitt lymphoma (BL) [MIM:113970]. A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass. Note=Chromosomal aberrations involving MYC are usually found in Burkitt lymphoma. Translocations t(8;14), t(8;22) or t(2;8) which juxtapose MYC to one of the heavy or light chain immunoglobulin gene loci. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain. -
Post-translational
modificationsPhosphorylated by PRKDC. Phosphorylation at Thr-58 and Ser-62 by GSK3 is required for ubiquitination and degradation by the proteasome.
Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-58 and Ser-62, leading to its degradation by the proteasome. In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation. In the nucleolus, however, ubiquitination is not counteracted by USP28, due to the lack of interaction between isoform 4 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus. Also polyubiquitinated by the DCX(TRUSS) complex. -
Cellular localization
Nucleus > nucleoplasm. Nucleus > nucleolus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab135024 has not yet been referenced specifically in any publications.