Recombinant Human C10orf54 protein (Fc Chimera) (ab214827)

Description

  • Product name

    Recombinant Human C10orf54 protein (Fc Chimera)
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITAA
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      33 to 194
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • C10orf54
    • Platelet receptor Gi24
    • Sisp-1
    • Stress-induced secreted protein-1
    • V-set domain-containing immunoregulatory receptor
    • V-type immunoglobulin domain-containing suppressor of T-cell activation
    • VISTA_HUMAN
    see all
  • Relevance

    Function: Immunoregulatory receptor which inhibits the T-cell response (PubMed:24691993). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (By similarity). May stimulate MMP14-mediated MMP2 activation (PubMed:20666777). Tissue specificity: Expressed in spleen. Detected on a number of myeloid cells including CD11b monocytes, CD66b+ neutrophils, at low levels on CD4+ and CD8+ T-cells, and in a subset of NK cells. Not detected on B cells (at protein level). Expressed at high levels in placenta, spleen, plasma blood leukocytes, and lung. Expressed at moderate levels in lymph node, bone marrow, fat, uterus, and trachea. Has low expression levels in other tissues. Similarity: Contains 1 Ig-like V-type (immunoglobulin-like) domain. PTM: At the cell surface, may be cleaved by MMP14. N-glycosylated.

References

ab214827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up