Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMG VLAREAPHLEKQPAAGPQRVLPGEREERPPTLSASFRTMAEFMDYTSSQC GKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGS YQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDS GQSVDLVFPV
    • Amino acids
      1 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AKIP1
    • BCA3
    • Breast cancer associated gene 3 protein
    • Chromosome 11 open reading frame 17
    • Koyt binding protein
    • PKA interacting protein
    • Proline rich protein BCA3
    • Protein kinase A interacting protein 1
    see all
  • Relevance
    C11orf17 is a nuclear protein and known to bind to the amino terminus (residues 1-39) of the C subunit of PKA. It is a binding partner of NF-kappaB p65 subunit, and enhances NF-kappaB-mediated gene expression.
  • Cellular localization
    Nuclear

Images

  • ab163390 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up