Recombinant Human C13orf8 protein (ab166140)

Overview

  • Product name
    Recombinant Human C13orf8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLG KMIFYQKSAKLFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLN KETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTP LTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPPKSVPVCESQKLA PVPSPEPQKPAPVSPESVKATLSNPKPQKQSHFPETLGPPSASSPESPVL AASPEPWGPSPAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP RRPAPAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKP IPSVSPGPWKPTPSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKT APTLSPEHWKAVPPVSPELRKPGPPLSPEIRSPAGSPELRKPSGSPDLWK LSPDQRKTSPASLDFPESQKSSRGGSPDLWKSSFFIEPQKPVFPETRKPG PSGPSESPKAASDIWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRAL FPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEEL LASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQE SSSDQEQVDVESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAK YMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLE SLLKNHVAAHGQSLLKCPRCNFESNFPRGFKKHLTHCQSRHNEEANKKLM EALEPPLEEQQI
    • Amino acids
      1 to 812
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C13orf8
    • CAMP
    • CHAMP
    • CHAMP1
    • CHAP1_HUMAN
    • chromosome 13 open reading frame 8
    • Chromosome alignment-maintaining phosphoprotein 1
    • FLJ90413
    • KIAA1802
    • Zinc finger protein 828
    • Zinc finger protein KIAA1802
    • ZNF828
    see all
  • Function
    Required for proper alignment of chromosomes at metaphase and their accurate segregation during mitosis. Involved in the maintenance of spindle microtubules attachment to the kinetochore during sister chromatid biorientation. May recruit CENPE and CENPF to the kinetochore.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated by CDK1. Mitotic phosphorylation is required for the attachment of spindle microtubules to the kinetochore.
  • Cellular localization
    Nucleus. Chromosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt

Images

  • ab166140 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up