Recombinant Human C15orf15 protein (ab162451)

Overview

  • Product name
    Recombinant Human C15orf15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVR WTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIK QKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
    • Amino acids
      1 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L30 isolog
    • Chromosome 15 open reading frame 15
    • Homolog of yeast ribosomal like protein 24
    • HRP L30 iso
    • L30
    • My024
    • My024 protein
    • Probable ribosome biogenesis protein RLP24
    • Ribosomal L24 domain-containing protein 1
    • Ribosomal protein L24 like
    • Ribosomal protein L24-like
    • RLP 24
    • RLP24
    • RLP24_HUMAN
    • RPL 24
    • RPL24
    • RPL24L
    • RSL24D1
    • TVAS3
    see all
  • Function
    Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.
  • Sequence similarities
    Belongs to the ribosomal protein L24e family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab162451 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up