Overview

  • Product name
    Recombinant Human C16orf62 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVFPWHSRNRNYKAEFASCRLEAVPLEFGDYHPLKPITVTESKTKKVNR KGSTSSTSSSSSSSVVDPLSSVLDGTDPLSMFAATADPAALAAAMDSSRR KRDRDDNSVVGSDFEPWTNKRGEILARYTTTEKLSINLFMGSEKGKAGTA TLAMSEKVRTRLEELDDFEEGSQKELLNLTQQDYVNRIEELNQSLKDAWA SDQKVKALKIVIQCSKLLSDTSVIQFYPSKFVLITDILDTFGKLVYERIF SMCVDSRSVLPDHFSPENANDTAKETCLNWFFKIASIRELIPRFYVEASI LKCNKFLSKTGISECLPRLTCMIRGIGDPLVSVYARAYLCRVGMEVAPHL KETLNKNFFDFLLTFKQIHGDTVQNQLVVQGVELPSYLPLYPPAMDWIFQ CISYHAPEALLTEMMERCKKLGNNALLLNSVMSAFRAEFIATRSMDFIGM IKECDESGFPKHLLFRSLGLNLALADPPESDRLQILNEAWKVITKLKNPQ DYINCAEVWVEYTCKHFTKREVNTVLADVIKHMTPDRAFEDSYPQLQLII KKVIAHFHDFSVLFSVEKFLPFLDMFQKESVRVEVCKCIMDAFIKHQQEP TKDPVILNALLHVCKTMHDSVNALTLEDEKRMLSYLINGFIKMVSFGRDF EQQLSFYVESRSMFCNLEPVLVQLIHSVNRLAMETRKVMKGNHSRKTAAF VRACVAYCFITIPSLAGIFTRLNLYLHSGQVALANQCLSQADAFFKAAIS LVPEVPKMINIDGKMRPSESFLLEFLCNFFSTLLIVPDHPEHGVLFLVRE LLNVIQDYTWEDNSDEKIRIYTCVLHLLSAMSQETYLYHIDKVDSNDSLY GGDSKFLAENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILA HGDLRNNKLNQLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHL TELALRLPLQTRT
    • Amino acids
      1 to 963
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C16orf62
    • Chromosome 16 open reading frame 62
    • CP062_HUMAN
    • DKFZp313M0539
    • DKFZp434B0212
    • Esophageal cancer associated protein
    • Esophageal cancer-associated protein
    • FLJ21040;
    • Hypothetical protein LOC57020
    • MGC16824
    • UPF0505 protein C16orf62
    see all
  • Function
    Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Seems not to be required for CCC complex stability (PubMed:25355947).
  • Sequence similarities
    Belongs to the UPF0505 family.
  • Cellular localization
    Membrane. Early endosome.
  • Information by UniProt

Images

  • ab163464 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up