Description

  • Product name

    Recombinant Human C16orf70 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQS PLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKLKYCGVHFNSQA IAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQLDSWTEAPKYE PNFAHGLASLQIPHGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAES VDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLS MLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDAN THKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADGQTETCTTYSK WDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNH IASVTLYGPPRPGSHLRTAELP
    • Amino acids

      1 to 422
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164237 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C16orf6
    • C16orf70
    • Chromosome 16 open reading frame 70
    • CP070_HUMAN
    • FLJ12076
    • Lin 10
    • Lin 10 homolog
    • LIN10
    • UPF0183 protein C16orf70
    see all
  • Sequence similarities

    Belongs to the UPF0183 family.
  • Information by UniProt

Images

  • ab164237 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164237 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164237.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up