Overview

  • Product name
    Recombinant Human C17orf27 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSL RDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE
    • Amino acids
      2016 to 2112
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALK lymphoma oligomerization partner on chromosome 17
    • ALO17_HUMAN
    • C17orf27
    • Chromosome 17 open reading frame 27
    • E3 ubiquitin-protein ligase RNF213
    • FLJ13051
    • KIAA1554
    • KIAA1618
    • MGC46622
    • MGC9929
    • MYMY2
    • Mysterin
    • MYSTR
    • NET57
    • Protein ALO17
    • RING finger protein 213
    • RNF 213
    • RNF213
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving ALO17 is associated with anaplastic large-cell lymphoma (ALCL). Translocation t(2;17)(p23;q25) with ALK.
  • Information by UniProt

Images

  • ab163622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up