Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSLLGEKVDTQPNVLHNDPHARHSDDNGQ NHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKH VKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHE HYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGY MSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGD SRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAV SFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDT KVKLGNP
    • Molecular weight
      41 kDa including tags
    • Amino acids
      30 to 363
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab167826 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • B3Gal T8
    • Beta 1 3 galactosyltransferase
    • C1GALT
    • Core 1 beta1 3 galactosyltransferase 1
    • Core 1 beta3 Gal T
    • Core 1 O glycan T synthase
    • Core 1 synthase glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1
    • Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1 3 galactosyltransferase
    • Glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1
    • T synthase
    see all
  • Relevance
    C1GALT1 (Core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) is a glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R. Core 1 is a precursor for many extended O-glycans in glycoproteins. C1GALT1 plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.
  • Cellular localization
    Membrane; Single-pass type II membrane protein.

Images

  • 15% SDS-PAGE analysis of ab167826 (3µg).

References

ab167826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up