Overview

  • Product name

    Recombinant Human C1orf77/FOP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASA RNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAI GGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMG LRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRG RGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
    • Amino acids

      1 to 248
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as C1orf77, Fop

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C1orf77
    • chromatin target of chromatin target of PRMT1 protein
    • Chromatin target of PRMT1
    • Chromatin target of PRMT1 protein
    • Chromosome 1 open reading frame 77
    • CHTOP
    • CHTOP_HUMAN
    • DKFZp547E1010
    • FL- RP1-178F15.2
    • FL-SRAG
    • FOP
    • Friend of PRMT1
    • Friend of PRMT1 protein
    • HT031
    • MGC131924
    • MGC86949
    • OTTHUMP00000035122
    • OTTHUMP00000035123
    • Pp7704
    • RP1 178F15.2
    • Small arginine- and glycine-rich protein
    • Small protein rich in arginine and glycine
    • SRAG
    • SRAG-3
    • SRAG-5
    see all
  • Function

    Plays an important role in the ligand-dependent activation of estrogen receptor target genes (PubMed:19858291). May play a role in the silencing of fetal globin genes (PubMed:20688955). Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (By similarity). Plays an important role in the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC is recruited to selective sites on the chromosome, where it methylates H4R3 and activates the transcription of genes involved in glioblastomagenesis (PubMed:25284789).
    Required for effective mRNA nuclear export and is a component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Stimulates DDX39B ATPase and helicase activities. In cooperation with ALYREF/THOC4 enhances NXF1 RNA binding activity (PubMed:23299939).
  • Tissue specificity

    Expressed in an erythroid progenitor cell line derived from peripheral blood. Expressed in glioblastoma cells (PubMed:25284789).
  • Post-translational
    modifications

    Asymmetrically methylated by PRMT1 (PubMed:25284789). Symmetrically methylated by PRMT5.
  • Cellular localization

    Nucleus. Nucleus, nucleolus. Nucleus, nucleoplasm. Nucleus speckle. Mostly associated with facultative heterochromatin (By similarity). Localizes to regions surrounding nuclear speckles known as perispeckles in which TREX complex assembly seems to occur (PubMed:23826332).
  • Information by UniProt

Images

  • ab161896 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up