Overview

  • Product name
    Recombinant Human C20orf186 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQQSDALHSALREVPLGVGDIPYNDFHVRGPPPVYTNGKKLDGIYQYGH IETNDNTAQLGGKYRYGEILESEGSIRDLRNSGYRSAENAYGGHRGLGRY RAAPVGRLHRRELQPGEIPPGVATGAVGPGGLLGTGGMLAADGILAGQGG LLGGGGLLGDGGLLGGGGVLGVLGEGGILSTVQGITGLRIVELTLPRVSV RLLPGVGVYLSLYTRVAINGKSLIGFLDIAVEVNITAKVRLTMDRTGYPR LVIERCDTLLGGIKVKLLRGLLPNLVDNLVNRVLADVLPDLLCPIVDVVL GLVNDQLGLVDSLIPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGG GLIDYPLGWPAVSPKPMPELPPMGDNTKSQLAMSANFLGSVLTLLQKQHA LDLDITNGMFEELPPLTTATLGALIPKVFQQYPESCPLIIRIQVLNPPSV MLQKDKALVKVLATAEVMVSQPKDLETTICLIDVDTEFLASFSTEGDKLM IDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLGSGVP LPKILNIDFSNADIDVLEDLLVLSA
    • Amino acids
      1 to 575
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPI fold-containing family B member 4
    • Bpifb4
    • C20orf186
    • dJ726C3.5
    • Gm1006
    • Ligand-binding protein RY2G5
    • Long palate, lung and nasal epithelium carcinoma-associated protein 4
    • LPLC4_HUMAN
    • Lplunc4
    see all
  • Function
    May have the capacity to recognize and bind specific classes of odorants. May act as a carrier molecule, transporting odorants across the mucus layer to access receptor sites. May serve as a primary defense mechanism by recognizing and removing potentially harmful odorants or pathogenic microorganisms from the mucosa or clearing excess odorant from mucus to enable new odorant stimuli to be received.
  • Tissue specificity
    Expressed in nasal tissue.
  • Sequence similarities
    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization
    Secreted. Cytoplasm.
  • Information by UniProt

Images

  • ab165597 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up