Overview

  • Product name
    Recombinant Human C20orf30 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALAT VLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIA YYASKGYRGYSYDDIPDFDD
    • Amino acids
      1 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf30
    • Chromosome 20 open reading frame 30
    • CT030_HUMAN
    • dJ1116H23.2.1
    • HSPC274
    • Hypothetical protein LOC29058
    • OTTHUMP00000030179
    • OTTHUMP00000030181
    • OTTHUMP00000030182
    • OTTHUMP00000030183
    • OTTHUMP00000030184
    • OTTHUMP00000030185
    • OTTHUMP00000030186
    • OTTHUMP00000030187
    • RP5-1116H23.2
    • UPF0414 transmembrane protein C20orf30
    see all
  • Sequence similarities
    Belongs to the UPF0414 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162204 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up