Description

  • Product name

    Recombinant Human C20orf77 protein
  • Purity

    > 90 % SDS-PAGE.
    ab202606 was purified using conventional chromatography techniques..
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSSFSESALEKKLSELSNSQQSVQTLS LWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEF TREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKL SMEDSKSPPPKATEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLT EELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLS KTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLE EYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 326
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_067038.

Specifications

Our Abpromise guarantee covers the use of ab202606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 20% Glycerol, 79% PBS, 0.02% DTT

General Info

  • Alternative names

    • C20orf77
    • Cell cycle related and expression elevated protein in tumor
    • Chromosome 20 open reading frame 77
    • CREPT
    • dJ1057B20.2
    • DKFZp434P0735
    • FLJ44520
    • Hypothetical protein LOC58490
    • NET60
    • Regulation of nuclear pre mRNA domain containing 1B
    • Regulation of nuclear pre mRNA domain containing protein 1B
    • Uncharacterized protein C20orf77
    see all
  • Relevance

    C20orf77 interacts with the phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It also revents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.
  • Cellular localization

    Nuclear

Images

  • 15% SDS-PAGE analysis of ab202606 (3 μg).

References

ab202606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up