Description

  • Product name

    Recombinant Human C21orf2 protein
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVN SISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCC GTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAAPEREGT GHGGPKLCCTLSSLSSAAETGRDPLDSEEEATGAQDERGLKPPSRGQFPS LSARDASSSHRGRVSGGPLGAAAASAHCTHCTETVGREHGASQGPVGREH GASQGLEELCPRGSCVCGSVNAHTRVTRAPHGAVLAPQPLLLSWSVECGP GPCWAEGNRSHVEEVPHTRPQAGLLCSDSPSVPNVLTAILLLLRELDAEG LEAVQQTVGSRLQALRGEEVQEHAE
    • Predicted molecular weight

      40 kDa
    • Amino acids

      1 to 375

Associated products

Specifications

Our Abpromise guarantee covers the use of ab235733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • A2
    • C21orf HUMF09G8.5
    • C21orf-HUMF09G8.5
    • C21orf2
    • Chromosome 21 open reading frame 2
    • CU002_HUMAN
    • Hypothetical protein LOC755
    • Nuclear encoded mitochondrial protein cDNA A2 YF5
    • Protein C21orf2
    • Uncharacterized protein C21orf2
    • YF 5
    • YF5
    • YF5/A2
    see all
  • Function

    May play roles in cilia formation and/or maintenance (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization.
  • Sequence similarities

    Contains 3 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    To C.elegans F09G8.5.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab235733.

References

ab235733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up