Overview

  • Product name
    Recombinant Human C21orf7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRY FAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLAT GDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCH DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA AELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
    • Amino acids
      1 to 242
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome 21 open reading frame 7
    • HC21ORF7
    • MAP3K7 c-terminal like
    • MAP3K7CL
    • Putative gene TGF beta activated kinase like
    • putative gene, TGF-beta-activated kinase like11
    • TAK1 like
    • TAK1 like protein
    • TAK1-like protein
    • TAK1-like protein 1
    • TAK1-like protein 2
    • TAK1-like protein 4
    • Tak1l
    • TAK1L_HUMAN
    • TAKL
    • TAKL-2
    • TAKL-4
    • TGF-beta activated kinase2
    see all
  • Tissue specificity
    Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and prostatic adenocarcinoma PC3.
  • Sequence similarities
    To the C-terminal domain of MAP3K7.
  • Information by UniProt

Images

  • ab163424 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up