Overview

  • Product name

    Recombinant Human C3a R protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGL KMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPS IIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVA FVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENI VQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLT SQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSV IMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLS LLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSI QGILEAAFSEELTRSTHCPSNNVISERNSTTV
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 482

Specifications

Our Abpromise guarantee covers the use of ab152249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

    Previously labelled as C3a Receptor.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AZ 3B
    • AZ3B
    • C3a anaphylatoxin chemotactic receptor
    • C3A R
    • C3A R1
    • C3a Receptor
    • C3a-R
    • C3AR
    • C3AR_HUMAN
    • C3AR1
    • C3R1
    • Complement component 3 receptor 1
    • Complement component 3a receptor 1
    • HNFAG09
    see all
  • Function

    Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Tissue specificity

    Widely expressed in several differentiated hematopoietic cell lines, in the lung, spleen, ovary, placenta, small intestine, throughout the brain, heart, and endothelial cells. Mostly expressed in lymphoid tissues.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Among the sulfation sites Tyr-174 is essential for binding of C3a anaphylatoxin.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up