Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGQEDPVQREIHQDWANREYIEIITS SIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 75
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_060932

Specifications

Our Abpromise guarantee covers the use of ab177597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab177597 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • BRICK1, SCAR/WAVE actin nucleating complex subunit
    • BRICK1, SCAR/WAVE actin nucleating complex subunit, homolog
    • BRK1
    • Brk1-like
    • C3orf10 chromosome 3 open reading frame 10
    • C3ORF10 GENE
    • Chromosome 3 open reading frame 10
    • Haematopoietic stem/progenitor cell protein 300
    • hHBrk1
    • HSPC300
    • MDS027
    • Probable protein BRICK1
    • Protein BRICK1
    see all
  • Relevance
    C3orf10 is involved in regulation of actin and microtubule organization and is part of a WAVE complex that activates the Arp2/3 complex.
  • Cellular localization
    Cytoplasm, cytoskeleton

Images

  • 15% SDS-PAGE analysis of 3µg ab177597.

References

ab177597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up