Overview

  • Product name

    Recombinant Human C4BPA protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNS DGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIG STTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFS VTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGE MVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNS CINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVIC QKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFS CHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKE EIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDK DQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQ VLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
    • Amino acids

      49 to 597
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C4b-binding protein alpha chain
    • C4bp
    • C4bpa
    • C4BPA_HUMAN
    • Complement component 4 binding protein
    • Complement component 4 binding protein alpha
    • Proline-rich protein
    • PrP
    • RP11-164O23.4
    see all
  • Function

    Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
  • Tissue specificity

    Chylomicrons in the plasma.
  • Sequence similarities

    Contains 8 Sushi (CCP/SCR) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab157987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up