Description

  • Product name

    Recombinant Human C4d protein
    See all C4d proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab198640 was expressed in E.coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSY VRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRY LDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRS MQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANS FLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEG KAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGL NVTLSSTGR
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      957 to 1336
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      cDNA was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal (NP_009224.2).

Specifications

Our Abpromise guarantee covers the use of ab198640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • acidic C4
    • Acidic complement C4
    • basic C4
    • basic complement C4
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3
    • C4
    • C4, chido form
    • C4, Rodgers form
    • C4-1
    • C4A
    • C4a anaphylatoxin
    • C4A2
    • C4A3
    • C4A4
    • C4A6
    • C4AD
    • C4b
    • C4B_2
    • C4B1
    • C4B12
    • C4B2
    • C4B3
    • C4B5
    • C4BD
    • C4d
    • C4d fragment
    • C4F
    • C4S
    • CH
    • Chido form of C4
    • CO4
    • CO4A_HUMAN
    • Complement C4 A
    • Complement C4 B
    • Complement C4 gamma chain
    • complement C4-A
    • complement C4-B
    • complement C4-B-like
    • complement C4B1a
    • Complement component 4A
    • complement component 4A (Rodgers blood group)
    • Complement component 4B
    • complement component 4B (Chido blood group)
    • complement component 4B (Chido blood group), copy 2
    • complement component 4B (Chido blood group)-like
    • Complement component 4F
    • Complement component 4S
    • CPAMD2
    • CPAMD3
    • DADB-112B14.11
    • MGC164979
    • RG
    • Rodgers form of C4
    see all
  • Function

    C4 plays a central role in the activation of the classical pathway of the complement system. It is processed by activated C1 which removes from the alpha chain the C4a anaphylatoxin. The remaining alpha chain fragment C4b is the major activation product and is an essential subunit of the C3 convertase (C4b2a) and the C5 convertase (C3bC4b2a) enzymes of the classical complement pathway.
    Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
  • Involvement in disease

    Defects in C4A are the cause of complement component 4A deficiency (C4AD) [MIM:120810]. A rare defect of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus with or without associated glomerulonephritis.
  • Sequence similarities

    Contains 1 anaphylatoxin-like domain.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    Prior to secretion, the single-chain precursor is enzymatically cleaved to yield the non-identical chains (alpha, beta and gamma). During activation, the alpha chain is cleaved by C1 into C4a and C4b, and C4b stays linked to the beta and gamma chains. Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab198640, using BSA as a reference control protein. 4-20% gradient gel was used.

    Lane 1: 10µg BSA

    Lane 2: 5µg BSA

    Lane 3: 1µg BSA

    Lane 4: 10µl ab198640

    Lane 5: 5µl ab198640

    Lane 6: 1µl ab198640

References

ab198640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up