Recombinant human C5a protein (ab167724)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human C5a protein
See all C5a proteins and peptides -
Biological activity
ab167724 is active based on enzyme release assay of myeloperoxidase. The ED50 = 1.36 nM. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAF TECCVVASQLRANISHKDMQLGR -
Predicted molecular weight
8 kDa -
Amino acids
679 to 751
-
Specifications
Our Abpromise guarantee covers the use of ab167724 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 99% PBS
Normally trehalose and mannitol are added as protectants before lyophilization.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Relevance
Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Images
-
Human C5a, Tag Free on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized Human C5a, Tag Free at 2 µg/mL (100 µL/well) can bind Anti-C5a Mab, Human IgG1 with a linear range of 0.8-13 ng/mL.
-
Human C5a, Tag Free induce N-acetyl-?-D-glucosaminidase release from differentiated U937 cells. The ED50 for this effect is 0.215-0.323 µg/mL.
-
SDS-PAGE of reduced ab167724 stained overnight with Coomassie Blue (6µg).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab167724 has not yet been referenced specifically in any publications.